Home Tools
Log in
Cart

Search Result

Search Results for " angiotensin-converting enzyme 2 "

Targets

23

Compounds

3

Natural Products

327

Recombinant Proteins

1

Libraries

Cat No. Product Name Synonyms Targets
T0805 Quinapril hydrochloride CI-906,PD-109452-2,Quinapril HCl RAAS
Quinapril hydrochloride (PD-109452-2) is an angiotensin-converting enzyme (ACE) inhibitor used in the therapy of hypertension and congestive heart failure. Quinapril hydrochloride is associated with a low rate of transie...
T13865 Resorcinolnaphthalein RAAS
Resorcinolnaphthalein is a specific enhancer of angiotensin-converting enzyme 2 (ACE2) (EC50 value of 19.5 μM).
T9109 SSAA09E2 RAAS , SARS-CoV
SSAA09E2 is a new SARS-CoV replication inhibitor, acting by blocking early interactions of SARS-S with the receptor for SARS-CoV, Angiotensin Converting Enzyme-2 (ACE2).
T76605 Abz-Ser-Pro-3-nitro-Tyr
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) [1] .
T76090 Mca-YVADAP-Lys(Dnp)-OH
Mca-YVADAP-Lys(Dnp)-OH serves as a fluorogenic substrate specifically for caspase-1 and angiotensin-converting enzyme 2 (ACE2) [1].
T76200 STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1].
T83602 (+)-Chloroquine
(+)-Chloroquine, an aminoquinoline drug, inhibits the in vitro terminal glycosylation of angiotensin-converting enzyme 2 (ACE-2) [1].
T80048 Mca-YVADAP-Lys(Dnp)-OH TFA
Mca-YVADAP-Lys(Dnp)-OH TFA serves as a fluorogenic substrate specifically utilized for caspase-1 and angiotensin-converting enzyme 2 (ACE2) [1].
T36622 Angiotensin I/II (1-6) (TFA)
Angiotensin I/II (1-6) TFA is a chemical compound comprising amino acids 1-6. It is derived from the Angiotensin I/II peptide, which is formed by the cleavage of the precursor angiotensinogen by renin. The resulting Angi...
T80099 Ovalbumin (154-159) Angiotensin-converting Enzyme (ACE)
Ovalbumin (154-159), a peptide fragment derived from ovalbumin, acts as a potent inhibitor of the angiotensin-converting enzyme (ACE) and is utilized in hypertension research [1] [2].
T35324 DX600
DX600 is a useful organic compound for research related to life sciences. The catalog number is T35324 and the CAS number is 478188-26-0.
T36942 SSAA09E1 SSAA09E1
SSAA09E1 is an inhibitor of severe acute respiratory syndrome coronavirus (SARS-CoV) viral entry.1It reduces infection of HEK293T cells transiently transfected with angiotensin-converting enzyme 2 (ACE2) by an HIV-based ...
T74109 Captopril EP Impurity B
Captopril EP Impurity B, a degradation product of Captopril (SQ-14534), serves as a thiol-containing, competitive inhibitor of the angiotensin-converting enzyme (ACE), demonstrating oral activity and potent antihypertens...
T80100 Ovotransferrin (328-332) Angiotensin-converting Enzyme (ACE)
Ovotransferrin (328-332), with an IC50 of 20 μM, exhibits protective activity against hypertension by inhibiting the Angiotensin-Converting Enzyme (ACE) and also displays anti-Cholinesterase (ChE) activity, suggesting a ...
T76610 Hippuryl-His-Leu-OH
Hippuryl-His-Leu-OH serves as a substrate to measure angiotensin I converting enzyme activity. Upon its cleavage, the resultant His-Leu moiety reacts with o-phthaldialdehyde or Fluorescamine, facilitating fluorescence de...
T80587 Alunacedase alfa HrsACE2,GSK 2586881 SARS-CoV
Alunacedase alfa (HrsACE2; GSK 2586881), a genetically modified human recombinant soluble angiotensin-converting enzyme-2 (hrsACE2), inhibits SARS-CoV-2 cell entry by competing with membrane-bound ACE2, offering potentia...
T73810 H-Ile-Pro-Pro-OH hydrochloride
H-Ile-Pro-Pro-OH hydrochloride, a tripeptide derived from milk [1], functions as an inhibitor of the angiotensin-converting enzyme (ACE) [1], demonstrating an inhibitory concentration (IC 50) of 5 μM [2]. This compound i...
T75752 N-Acetyl-Ser-Asp-Lys-Pro acetate
N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate, a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE), functions as a natural inhibitor of pluripotent hematopoietic stem cell proliferatio...
T76613 H-Pro-Phe-OH
H-Pro-Phe-OH, a dipeptide composed of proline and phenylalanine, functions both as a substrate for prolinase and in polypeptide synthesis. Phenylalanine, an aromatic amino acid within this compound, has the capability to...
T60383 Captopril hydrochloride
Captopril (SQ 14225) hydrochloride is an antihypertensive agent that is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor with IC 50 of 0.025 μM and has been widely used for rese...
T68616 Pentoprilat
Pentoprilat is a member of a series of l-glutarylindoline-2(S)-carboxylic acid derivatives. Pentopril was evaluated as an inhibitor of a cell-free preparation of angiotensin-converting enzyme (ACE) isolated from rabbit l...
T60935 H-Tyr-Phe-OH
H-Tyr-Phe-OH (L-Tyrosyl-L-phenylalanine) can be used as the biomarker to distinguish benign thyroid nodules (BTN) from thyroid cancer (TC). H-Tyr-Phe-OH is an orally active Angiotensin-converting enzyme inhibitor with t...
T83742 SBP1 TFA Spike Binding Peptide 1
Spike Binding Peptide 1 (SBP1), representing amino acids 21-43 of angiotensin-converting enzyme 2 (ACE2), has been utilized in a novel approach involving lipid nanoparticles (LNPs) encapsulated with oseltamivir phosphate...
Cat No. Product Name Synonyms Targets
T3851 Vicenin 2 Vicenin -2 RAAS
Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC50=43.83 μM) from the aerial parts of Desmodium styracifolium. Vicenin 2 is an inhibitor of α-glucosidase, PTP1B, and RLAR. Vicenin 2 has hepatoprotective,...
T5S0106 Peimisine Ebeiensine RAAS , AChR
1. Peimisine (Ebeiensine) can affect M-receptor, excit β-receptor, restrain the release of internal calcium, and promote to releaseing nitrogen monoxidum in order to relax tracheal smooth muscle and relieve asthma. 2. Pe...
TN4860 Pueroside B COX , PPAR
Pueroside B may can treat coronary heart disease, it can interact with two or more targets[peroxisome proliferator activated receptor γ (PPAR-γ), angiotensin-converting enzyme (ACE), hydroxymethylglutaryl coenzyme A rece...

Recombinant Proteins

Cat No. Product Name Species Expression System
TMPY-02207 ACE2/ACEH Protein, Rat, Recombinant (His) Rat HEK293 Cells
ACE2/ACEH Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 85 kDa and the accession number is Q5EGZ1.
TMPY-03830 ACE2/ACEH Protein, Rhesus, Recombinant (His) Rhesus HEK293 Cells
ACE2/ACEH Protein, Rhesus, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 85.1 kDa and the accession number is B6DUF3.
TMPY-03561 ACE2/ACEH Protein, Rhesus, Recombinant (hFc) Rhesus HEK293 Cells
ACE2/ACEH Protein, Rhesus, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 110.7kDa and the accession number is B6DUF3.
TMPY-05266 ACE2/ACEH Protein, Human, Recombinant (His) Human HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 85.1 kDa and the accession number is Q9BYF1-1.
TMPY-00655 ACE2/ACEH Protein, Human, Recombinant (hFc) Human HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 110.3 kDa and the accession number is Q9BYF1-1.
TMPY-05725 ACE2/ACEH Protein, Human, Recombinant (His & Avi), Biotinylated Human Baculovirus Insect Cells
ACE2/ACEH Protein, Human, Recombinant (His & Avi), Biotinylated is expressed in Baculovirus insect cells with His and Avi tag. The predicted molecular weight is 86.86 kDa and the accession number is Q9BYF1-1.
TMPY-04312 ACE2/ACEH Protein, Human, Recombinant (mFc) Human HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with mFc tag. The predicted molecular weight is 110 kDa and the accession number is Q9BYF1-1.
TMPY-06334 ACE2/ACEH Protein, Human, Recombinant (hFc), Biotinylated Human HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (hFc), Biotinylated is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 110.3 kDa and the accession number is NP_068576.1.
TMPY-05696 ACE2/ACEH Protein, Human, Recombinant (His), Biotinylated Human HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (His), Biotinylated is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 85.1 kDa and the accession number is Q9BYF1-1.
TMPY-01839 ACE2/ACEH Protein, Mouse, Recombinant (His & hFc) Mouse HEK293 Cells
ACE2/ACEH Protein, Mouse, Recombinant (His & hFc) is expressed in HEK293 mammalian cells with His and hFc tag. The predicted molecular weight is 112 kDa and the accession number is Q8R0I0-1.
TMPY-01838 ACE2/ACEH Protein, Mouse, Recombinant (His) Mouse HEK293 Cells
ACE2/ACEH Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 85 kDa and the accession number is Q8R0I0-1.
TMPJ-00386 ACE2/ACEH Protein, Human, Recombinant (HEK293, His & Avi), Biotinylated Human HEK293 Cells
Angiotensin-Converting Enzyme 2 (ACE-2) is an integral membrane protein and a zinc metalloprotease of the ACE family, the ACE family includes somatic and germinal ACE. ACE-2 cleaves angiotensins I and II as a carboxypept...
TMPH-03081 ACE2 Protein, Paguma larvata, Recombinant (hFc) Paguma larvata HEK293 Cells
ACE2 Protein, Paguma larvata, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 112.7 kDa and the accession number is Q56NL1.
TMPK-00383 ACE2/ACEH Protein, Human, Recombinant (His & Avi) Human HEK293 Cells
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio...
TMPK-00552 ACE2/ACEH Protein, Cynomolgus, Recombinant (His & Avi), Biotinylated Cynomolgus HEK293 Cells
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio...
TMPK-00551 ACE2/ACEH Protein, Cynomolgus, Recombinant (His & Avi) Cynomolgus HEK293 Cells
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio...
TMPK-00382 ACE2/ACEH Protein, Human, Recombinant (hFc & Avi), Biotinylated Human HEK293 Cells
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio...
TMPK-00432 SARS-COV-2 Spike S1 Protein (hFc & Avi) SARS-CoV-2 HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00440 SARS-COV-2 Spike S1 Protein (His & Avi), Biotinylated SARS-CoV-2 HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00437 SARS-COV-2 Spike RBD Protein (His & Avi) SARS-CoV-2 HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00441 SARS-COV-2 Spike S Trimer Protein (His & Avi), Biotinylated SARS-CoV-2 HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00442 SARS-COV-2 (Omicron B.1.1.529) Spike S Trimer Protein (His & Avi), Biotinylated SARS-CoV-2 HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00912 SARS Spike RBD Protein (His & Avi), Biotinylated SARS HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00909 SARS Spike S1 Protein (hFc & Avi), Biotinylated SARS HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00910 SARS Spike S1 Protein (His & Avi) SARS HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00439 SARS-COV-2 Spike RBD Protein (His & Avi), Biotinylated SARS-CoV-2 HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00433 SARS-COV-2 Spike S1 Protein (hFc & Avi), Biotinylated SARS-CoV-2 HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00434 SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated SARS-CoV-2 HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00444 SARS-COV-2 Spike S1 NTD Protein (His & Flag) SARS-CoV-2 HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00438 SARS-COV-2 Spike S Trimer Protein (His & Avi) SARS-CoV-2 HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00913 SARS Spike S1 Protein (His & Avi), Biotinylated SARS HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00908 SARS Spike S1 Protein (hFc & Avi) SARS HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00443 SARS-COV-2 (Omicron B.1.1.529) Spike S1 Protein (His & Avi), Biotinylated SARS-CoV-2 HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00911 SARS Spike RBD Protein (His & Avi) SARS HEK293 Cells
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPY-06885 SARS-CoV-2 XBB.1.16 (Omicron) Spike S1+S2 trimer Protein (ECD, His)
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-00005 FGF-8a Protein, Human, Recombinant Human E. coli
In mammalian embryos, transient Fgf8 expression defines the developing isthmic region, lying between the midbrain and the first rhombomere, but there has been uncertainty about the existence of a distinct isthmic segment...
TMPY-00891 Neuropilin-1 Protein, Human, Recombinant (V179A, hFc) Human HEK293 Cells
Neuropilin-1 Protein, Human, Recombinant (V179A, hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 96.5 kDa and the accession number is O14786-2.
TMPY-00871 LAYN Protein, Human, Recombinant (hFc) Human HEK293 Cells
LAYN Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 49.5 kDa and the accession number is Q6UX15-2.
TMPY-00341 FGFR3 Protein, Human, Recombinant (alpha IIIb, His) Human HEK293 Cells
FGFR3 Protein, Human, Recombinant (alpha IIIb, His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 40 kDa and the accession number is P22607-2.
TMPY-05288 PLGF/PGF Protein, Human, Recombinant (aa 19-149) Human E. coli
PLGF/PGF Protein, Human, Recombinant (aa 19-149) is expressed in E. coli expression system. The predicted molecular weight is 14.9 kDa and the accession number is P49763-2.
TMPY-04116 KRAS Protein,Human,Recombinant(G12C & Q61H, His) Human E. coli
KRAS Protein,Human,Recombinant(G12C & Q61H, His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 23.3 kDa and the accession number is P01116-2.
TMPY-00748 Nectin-2 Protein, Human, Recombinant Human HEK293 Cells
Nectin-2 Protein, Human, Recombinant is expressed in HEK293 mammalian cells. The predicted molecular weight is 36.2 kDa and the accession number is Q92692-2.
TMPY-00850 ST2/IL-1 RL1 Protein, Human, Recombinant Human HEK293 Cells
ST2/IL-1 RL1 Protein, Human, Recombinant is expressed in HEK293 mammalian cells. The predicted molecular weight is 35.6 kDa and the accession number is Q01638-2.
TMPY-02792 GDNF Protein, Human, Recombinant (HEK293) Human HEK293 Cells
GDNF Protein, Human, Recombinant (HEK293) is expressed in HEK293 mammalian cells. The predicted molecular weight is 15.1 kDa and the accession number is P39905-2.
TMPY-01691 Clusterin Protein, Human, Recombinant (CLU34, His) Human HEK293 Cells
Clusterin Protein, Human, Recombinant (CLU34, His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 51.5 kDa and the accession number is P10909-2.
TMPY-00849 ST2/IL-1 RL1 Protein, Human, Recombinant (hFc) Human HEK293 Cells
ST2/IL-1 RL1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 61.72 kDa and the accession number is Q01638-2.
TMPY-02011 CD96 Protein, Human, Recombinant (His) Human HEK293 Cells
CD96 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 55 kDa and the accession number is P40200-2.
TMPY-02358 CD98 Protein, Mouse, Recombinant (His) Mouse HEK293 Cells
CD98 Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 49.2 kDa and the accession number is P10852-2.
TMPJ-00850 ST2/IL-1 RL1 Protein, Mouse, Recombinant (aa 27-337, His) Mouse HEK293 Cells
ST2/IL-1 RL1 Protein, Mouse, Recombinant (aa 27-337, His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 55-70 KDa and the accession number is P14719-2.
TMPY-01985 CD32B/Fcgr2b Protein, Human, Recombinant (His & Avi), Biotinylated Human HEK293 Cells
CD32B/Fcgr2b Protein, Human, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 24 kDa and the accession number is P31994-2.
------------------------ More ------------------------
ACE2/ACEH Protein, Rat, Recombinant (His)
TMPY-02207
Species: Rat
Expression System: HEK293 Cells
ACE2/ACEH Protein, Rhesus, Recombinant (His)
TMPY-03830
Species: Rhesus
Expression System: HEK293 Cells
ACE2/ACEH Protein, Rhesus, Recombinant (hFc)
TMPY-03561
Species: Rhesus
Expression System: HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (His)
TMPY-05266
Species: Human
Expression System: HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (hFc)
TMPY-00655
Species: Human
Expression System: HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (His & Avi), Biotinylated
TMPY-05725
Species: Human
Expression System: Baculovirus Insect Cells
ACE2/ACEH Protein, Human, Recombinant (mFc)
TMPY-04312
Species: Human
Expression System: HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (hFc), Biotinylated
TMPY-06334
Species: Human
Expression System: HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (His), Biotinylated
TMPY-05696
Species: Human
Expression System: HEK293 Cells
ACE2/ACEH Protein, Mouse, Recombinant (His & hFc)
TMPY-01839
Species: Mouse
Expression System: HEK293 Cells
ACE2/ACEH Protein, Mouse, Recombinant (His)
TMPY-01838
Species: Mouse
Expression System: HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (HEK293, His & Avi), Biotinylated
TMPJ-00386
Species: Human
Expression System: HEK293 Cells
ACE2 Protein, Paguma larvata, Recombinant (hFc)
TMPH-03081
Species: Paguma larvata
Expression System: HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (His & Avi)
TMPK-00383
Species: Human
Expression System: HEK293 Cells
ACE2/ACEH Protein, Cynomolgus, Recombinant (His & Avi), Biotinylated
TMPK-00552
Species: Cynomolgus
Expression System: HEK293 Cells
ACE2/ACEH Protein, Cynomolgus, Recombinant (His & Avi)
TMPK-00551
Species: Cynomolgus
Expression System: HEK293 Cells
ACE2/ACEH Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPK-00382
Species: Human
Expression System: HEK293 Cells
SARS-COV-2 Spike S1 Protein (hFc & Avi)
TMPK-00432
Species: SARS-CoV-2
Expression System: HEK293 Cells
SARS-COV-2 Spike S1 Protein (His & Avi), Biotinylated
TMPK-00440
Species: SARS-CoV-2
Expression System: HEK293 Cells
SARS-COV-2 Spike RBD Protein (His & Avi)
TMPK-00437
Species: SARS-CoV-2
Expression System: HEK293 Cells
SARS-COV-2 Spike S Trimer Protein (His & Avi), Biotinylated
TMPK-00441
Species: SARS-CoV-2
Expression System: HEK293 Cells
SARS-COV-2 (Omicron B.1.1.529) Spike S Trimer Protein (His & Avi), Biotinylated
TMPK-00442
Species: SARS-CoV-2
Expression System: HEK293 Cells
SARS Spike RBD Protein (His & Avi), Biotinylated
TMPK-00912
Species: SARS
Expression System: HEK293 Cells
SARS Spike S1 Protein (hFc & Avi), Biotinylated
TMPK-00909
Species: SARS
Expression System: HEK293 Cells
SARS Spike S1 Protein (His & Avi)
TMPK-00910
Species: SARS
Expression System: HEK293 Cells
SARS-COV-2 Spike RBD Protein (His & Avi), Biotinylated
TMPK-00439
Species: SARS-CoV-2
Expression System: HEK293 Cells
SARS-COV-2 Spike S1 Protein (hFc & Avi), Biotinylated
TMPK-00433
Species: SARS-CoV-2
Expression System: HEK293 Cells
SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated
TMPK-00434
Species: SARS-CoV-2
Expression System: HEK293 Cells
SARS-COV-2 Spike S1 NTD Protein (His & Flag)
TMPK-00444
Species: SARS-CoV-2
Expression System: HEK293 Cells
SARS-COV-2 Spike S Trimer Protein (His & Avi)
TMPK-00438
Species: SARS-CoV-2
Expression System: HEK293 Cells
SARS Spike S1 Protein (His & Avi), Biotinylated
TMPK-00913
Species: SARS
Expression System: HEK293 Cells
SARS Spike S1 Protein (hFc & Avi)
TMPK-00908
Species: SARS
Expression System: HEK293 Cells
SARS-COV-2 (Omicron B.1.1.529) Spike S1 Protein (His & Avi), Biotinylated
TMPK-00443
Species: SARS-CoV-2
Expression System: HEK293 Cells
SARS Spike RBD Protein (His & Avi)
TMPK-00911
Species: SARS
Expression System: HEK293 Cells
SARS-CoV-2 XBB.1.16 (Omicron) Spike S1+S2 trimer Protein (ECD, His)
TMPY-06885
Species:
Expression System:
FGF-8a Protein, Human, Recombinant
TMPY-00005
Species: Human
Expression System: E. coli
Neuropilin-1 Protein, Human, Recombinant (V179A, hFc)
TMPY-00891
Species: Human
Expression System: HEK293 Cells
LAYN Protein, Human, Recombinant (hFc)
TMPY-00871
Species: Human
Expression System: HEK293 Cells
FGFR3 Protein, Human, Recombinant (alpha IIIb, His)
TMPY-00341
Species: Human
Expression System: HEK293 Cells
PLGF/PGF Protein, Human, Recombinant (aa 19-149)
TMPY-05288
Species: Human
Expression System: E. coli
KRAS Protein,Human,Recombinant(G12C & Q61H, His)
TMPY-04116
Species: Human
Expression System: E. coli
Nectin-2 Protein, Human, Recombinant
TMPY-00748
Species: Human
Expression System: HEK293 Cells
ST2/IL-1 RL1 Protein, Human, Recombinant
TMPY-00850
Species: Human
Expression System: HEK293 Cells
GDNF Protein, Human, Recombinant (HEK293)
TMPY-02792
Species: Human
Expression System: HEK293 Cells
Clusterin Protein, Human, Recombinant (CLU34, His)
TMPY-01691
Species: Human
Expression System: HEK293 Cells
ST2/IL-1 RL1 Protein, Human, Recombinant (hFc)
TMPY-00849
Species: Human
Expression System: HEK293 Cells
CD96 Protein, Human, Recombinant (His)
TMPY-02011
Species: Human
Expression System: HEK293 Cells
CD98 Protein, Mouse, Recombinant (His)
TMPY-02358
Species: Mouse
Expression System: HEK293 Cells
ST2/IL-1 RL1 Protein, Mouse, Recombinant (aa 27-337, His)
TMPJ-00850
Species: Mouse
Expression System: HEK293 Cells
CD32B/Fcgr2b Protein, Human, Recombinant (His & Avi), Biotinylated
TMPY-01985
Species: Human
Expression System: HEK293 Cells
Cat No. Product Name
L7110 Anti-Hypertension Compound Library

678 compounds
678 hypertension-related small molecules for high-throughput and high-content screening.
TargetMol